Protein Info for GFF3839 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: RND efflux system, membrane fusion protein CmeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00529: CusB_dom_1" amino acids 30 to 353 (324 residues), 50.9 bits, see alignment E=2.5e-17 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 33 to 370 (338 residues), 271.7 bits, see alignment E=3.5e-85 PF16576: HlyD_D23" amino acids 54 to 287 (234 residues), 39.3 bits, see alignment E=8.8e-14 PF13533: Biotin_lipoyl_2" amino acids 58 to 106 (49 residues), 31.2 bits, see alignment 3e-11 PF13437: HlyD_3" amino acids 169 to 284 (116 residues), 28.8 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 52% identical to MTRC_NEIGO: Membrane fusion protein MtrC (mtrC) from Neisseria gonorrhoeae

KEGG orthology group: K03585, membrane fusion protein (inferred from 76% identity to pna:Pnap_2887)

MetaCyc: 46% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>GFF3839 RND efflux system, membrane fusion protein CmeA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSVLALAVALAACGESAPPQAAAAGGGMPAPEVGVVTVTPGDVGLTTELPGRLEASRVAQ
VRARAAGILQERLFREGSDVKAGQALFRIDPAPYAAAQQSAQASLARSQANLTQATALAE
RYAPLVKENAISQQEYANAVAAQKQAEADVAAGKAAVQTANINLGYARVTAPISGRIGRA
LVTEGALVGQGEATQLAVIQQINPMYVNFTQSAAEVFKLRKAMESGQLKGAGSQAASVQV
VLEDGSVYEQPGRLLFSDLTVDSSTGQVTLRAEVPNPKGTLLPGLYVRVRLEQAKAGNAI
TLPQQAVTRSAQGDTVSVVGADGKISPRQVKVGGQQNGQWVILDGVKAGEQIMVDGFQKL
QMMPPGTPVKAVPWQASGSAPAAPAAAAPAPEAAK