Protein Info for GFF3837 in Xanthobacter sp. DMC5

Annotation: Diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR01048: diaminopimelate decarboxylase" amino acids 7 to 415 (409 residues), 472.4 bits, see alignment E=5e-146 PF02784: Orn_Arg_deC_N" amino acids 35 to 282 (248 residues), 198.2 bits, see alignment E=2.3e-62 PF01168: Ala_racemase_N" amino acids 36 to 230 (195 residues), 33.1 bits, see alignment E=7.2e-12 PF00278: Orn_DAP_Arg_deC" amino acids 181 to 373 (193 residues), 103.5 bits, see alignment E=9.2e-34

Best Hits

Swiss-Prot: 47% identical to DCDA_AQUAE: Diaminopimelate decarboxylase (lysA) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 89% identity to xau:Xaut_1740)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF3837 Diaminopimelate decarboxylase (Xanthobacter sp. DMC5)
MHHFDYRNGRLHAEDVDLTSLAAEVGTPFYCYATATLERHYRVFMEAFAGRDVLLCYALK
ANSNQSVISTLARLGAGADIVSAGELMRARAAGVPGERIVFSGVGKTREEMAQALDAGIL
CFNVESEPELDALSEVALSKGVKAPVSIRVNPDVDAKTHKKISTGKSATKFGIPISRARD
VYDFAARLPGLAISGVDMHIGSQITDMAPFENAVTLLAELARDLMAAGHRLHHMDLGGGL
GVPYAASDPVPPSPAAYAEVVGRALGDLKLPLVFEMGRMLVANAGILVTRVIYVKKGEGK
TFVVVDAAMNDLIRPTLYEAHHDIVPVAEPAAGAAMVVADVVGPVCETGDFLALDRLLPE
VKPGDLLAVMTAGAYGAVQSGTYNTRALVPEVLVRGPEAAVVRPRVDPAALIALDRPAPW
LG