Protein Info for GFF3834 in Xanthobacter sp. DMC5

Annotation: Aerobic cobaltochelatase subunit CobS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR01650: cobaltochelatase, CobS subunit" amino acids 8 to 324 (317 residues), 633.9 bits, see alignment E=2.7e-195 PF12556: CobS_N" amino acids 10 to 39 (30 residues), 62.7 bits, see alignment (E = 3e-21) PF07728: AAA_5" amino acids 66 to 188 (123 residues), 36.4 bits, see alignment E=7.6e-13

Best Hits

Swiss-Prot: 83% identical to COBS_SINSX: Aerobic cobaltochelatase subunit CobS (cobS) from Sinorhizobium sp.

KEGG orthology group: K09882, cobaltochelatase CobS [EC: 6.6.1.2] (inferred from 96% identity to xau:Xaut_1877)

MetaCyc: 83% identical to CobS (Pseudomonas denitrificans (nom. rej.))

Predicted SEED Role

"Aerobic cobaltochelatase CobS subunit (EC 6.6.1.2)" in subsystem Coenzyme B12 biosynthesis or Conenzyme B12 related Hypothetical: Clusters with cobST (EC 6.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.6.1.2

Use Curated BLAST to search for 6.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF3834 Aerobic cobaltochelatase subunit CobS (Xanthobacter sp. DMC5)
MSGLETTAPMPDMKVSVRQTFGIDIDMEVPAYSEADSHVPELDPDYLFDRPTTLAILAGF
ARNRRVMVTGFHGTGKSTHIEQVAARLNWPCVRINLDSHISRIDLIGKDAIVVKDGLQVT
EFRDGILPWAYQNNVALVFDEYDAGRPDVMFVIQRVLESSGRLTLLDQSRVIRPHGAFRL
FATANTIGLGDTTGLYHGTQQINQAQMDRWSIVTTLNYLAHDKEVDIVLAKAKHFQNVEG
RDTVNRMVRLADLTRQAFMNGDLSTVMSPRTVITWAENADIFRDIAFSLRVTFLNKCDEL
ERPLVAEFFQRCFGQELAESTVNVALS