Protein Info for GFF3833 in Variovorax sp. SCN45

Annotation: FIG01056426: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 350 (311 residues), 129.7 bits, see alignment E=1.3e-41 PF06779: MFS_4" amino acids 85 to 401 (317 residues), 26.7 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_1371)

Predicted SEED Role

"FIG01056426: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>GFF3833 FIG01056426: hypothetical protein (Variovorax sp. SCN45)
MMNSPSSNPCIDDVGAVPAASAAPAAAATRSAWLAVGSIAVGTFAMVSTEFMPIGLLTDI
ARGLNVSDGTAGLMVTMPGVLAAFAGPALIVASGKLDRRTVLIALTTLLIASNLLAAFAP
NFATMLVARLLLGLCVGGFWTFAPAAATQLVPHAAQARAMSYVLAGVSAATVLGVPAGSF
LGTLFGWRASFAVTGALATVVLLVQLWLLPAIPPVRAIGARDLLTPLTRRMAQVGLLAVL
FFIAGHFAAYTYLKPLLQQVFGLAPNSVSTLLLVYGAVGFIGTFLGGSLVARSVRATTLL
AALMLATALLLSTVIGTGFVPGAVVVVIWGVAFGLIPVALTGWMMEAVPDAPEAGQALLV
SGFQVAIASGALIGGVTVDNHGISSAMVLSGALVLIAALIVGTLGRARGGAPLAAIPE