Protein Info for GFF3827 in Variovorax sp. SCN45

Annotation: UPF0118 membrane protein SMc00793

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 62 to 86 (25 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 281 to 303 (23 residues), see Phobius details amino acids 309 to 339 (31 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details PF01594: AI-2E_transport" amino acids 74 to 413 (340 residues), 188.8 bits, see alignment E=7.7e-60

Best Hits

KEGG orthology group: None (inferred from 85% identity to vpe:Varpa_1504)

Predicted SEED Role

"FIG00931248: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>GFF3827 UPF0118 membrane protein SMc00793 (Variovorax sp. SCN45)
MSGERDASAGQTPASDAPEAPKPLEPAAEPPAAEPATAAAAVPAPEAPAASPARKRERER
LLLHMPVDVRSASLVVLAVLASVFALQWGQAVFIPLMLSLLLTYALSPLVDLLHRWKLPR
WIGAALILMGLFGGLGWTGYSLSGSASQLLDSLPVAAQKLGQAMRRDKNASATPLESVQA
AAAQLEKAAEENSAKVASRRGVARVIIERPGFNVRDYLLSGTVGLLSAMGQLTLVAFLTY
FALCSGDTFRRKLIKITGSSLQKKKVTVHVLDDITRNIERYLLVQILVSAVVGVATGLAF
WVIGVENAAVWGIIAGVTNLIPYIGSVIVLVAAGLVAFLQFNSLQMGIVVAGVSLGIHTL
IGNLLMPWLTSRTSRMNPVAVFVGVIFWGWLWGIWGLLLGIPITMVIKSICDRVEDLQPI
GELLGE