Protein Info for PS417_19585 in Pseudomonas simiae WCS417
Annotation: acyl-CoA dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to IVD_CAEEL: Probable acyl-CoA dehydrogenase 6 (acdh-6) from Caenorhabditis elegans
KEGG orthology group: K11731, citronellyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 98% identity to pfs:PFLU4395)MetaCyc: 88% identical to citronellyl-CoA dehydrogenase (Pseudomonas aeruginosa PAO1)
1.3.8.-
Predicted SEED Role
"Citronellyl-CoA dehydrogenase"
MetaCyc Pathways
- citronellol degradation (1/4 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Brassinosteroid biosynthesis
- Caprolactam degradation
- Fatty acid metabolism
- Geraniol degradation
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 1.3.99.-
Use Curated BLAST to search for 1.3.99.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UPB3 at UniProt or InterPro
Protein Sequence (385 amino acids)
>PS417_19585 acyl-CoA dehydrogenase (Pseudomonas simiae WCS417) MIFTQEHQALRRTVRAFVDREINPHVDAWEKAGRFPIHEIFRKAGDLGLLGISKPEKFGG MGLDYSYSIVAAEEFGTIRCGGIPMSIGVQTDMCTPALARFGSDELRDEFLRPAISGEQV GCIGVSETGAGSDVAGLKTHARKDGDDYVINGSKMWITNSPSADFICLLANTSDDKPHIN KSLIMVPMNTPGISVSPPLEKLGMHSSETAQVFFDDVRVPQRNRIGHEGAGFMMQMLQFQ EERLFGAANMIKGLEHCIDSTIDYCKERQTFGKALIDNQVIHFRLAELSTEIECLRALVY QATEQYIKGQDVTRLASMAKLKAGRLGREVSDSCLQYWGGMGFMWDNPVARAYRDVRLVS IGGGADEIMLGIICKLMGTLPGKKS