Protein Info for GFF3823 in Variovorax sp. SCN45

Annotation: FIG00581576: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details PF01694: Rhomboid" amino acids 150 to 295 (146 residues), 92.2 bits, see alignment E=1.9e-30

Best Hits

KEGG orthology group: None (inferred from 81% identity to vap:Vapar_1360)

Predicted SEED Role

"FIG00581576: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>GFF3823 FIG00581576: hypothetical protein (Variovorax sp. SCN45)
VFYAIPLENRPSWRNPPWMTVLLILLNMIVFWGPQRSEENARERAADYYVKSVLPALELP
PFVEWLEKADPKRGKLARRMLPHEEAYPQLLEGMQGEKQFMRKLQADEVVTPTDPQYGEW
KRDRQHYEAMLPEPFTRRWSHDHGKDAEFRPWTWITSAFLHGSTSHLLGNMLFLFLFGFS
VELALGRGTYLSFYLLGALGASLLAGWAYAGKGSYGLGASGAISALMGMYAVMYRLRRIR
FFYQLFFYFNYVTAPALLLLPAWIANELMQHWLGGQGIAYMAHLGGLLTGAALMAGALLL
RRVKAPETASAPEPDRFDEHVAAAQKYGAAMKFDRACAEWRAAAALRPGDTGTLRAWFNT
ARLQPASDDFHHAARRIFRLPATDPATLALQHASYKTYLDQAKPGARLKPDDMARLARRF
ARIREFGDADKLCRILLKTAPDHAELPDTLSACANGLLHAGERDRAVSLLPDLLRLAPND
MVTRALQRA