Protein Info for GFF3820 in Variovorax sp. SCN45

Annotation: Efflux transport system, outer membrane factor (OMF) lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 16 to 473 (458 residues), 388.6 bits, see alignment E=2e-120 PF02321: OEP" amino acids 70 to 257 (188 residues), 137.5 bits, see alignment E=2.2e-44 amino acids 288 to 472 (185 residues), 179.7 bits, see alignment E=2.5e-57

Best Hits

Swiss-Prot: 49% identical to TTGC_PSEPT: Toluene efflux pump outer membrane protein TtgC (ttgC) from Pseudomonas putida (strain DOT-T1E)

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_1497)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>GFF3820 Efflux transport system, outer membrane factor (OMF) lipoprotein (Variovorax sp. SCN45)
MFKRAFPLRSLALSAMASAVLAGCVNLAPEYTAPASPVPQALPSSGVEAPTPIDVSWRSF
FVEPRLRGTIELALANNRDLRVAALNIERARAQYGIARASLFPTVEAGAGGSRSRTPGSL
STGGEARIGSQYSADLGLTSYEIDLFGRVRNLGESALQSYFQTEETRRSTQISLIASVAT
AWLQLAADEQRLLLARNTLESQRKSFDLVQRSHRLGAQSGLALAQAQSTVDSARADAAAF
DSQVEQDRNALALLVGAMPPADLLPAAPASDTAAPADAARLLVPPPDLPSSVLNRRPDVR
AAEHALRASNADIGAARAAFFPRIALTASAGTASSTLSGLFAGGSQAWSFAPSISVPIFD
GGANRANLRVAEAQQKIQIATYEKAVQTAFREVADALAERRTLAERLDAQRSLLGATSRS
FELSQSLFRSGASSYLDVLDAQRAYYAAQQALIGLQLTEQTNRLTIYKTLGGGWEES