Protein Info for GFF3818 in Xanthobacter sp. DMC5

Annotation: putative N-octanoylanthranilate hydrolase AqdA1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF07859: Abhydrolase_3" amino acids 65 to 249 (185 residues), 33 bits, see alignment E=5.4e-12 PF12697: Abhydrolase_6" amino acids 65 to 244 (180 residues), 28.4 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: None (inferred from 64% identity to azc:AZC_0738)

Predicted SEED Role

"putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>GFF3818 putative N-octanoylanthranilate hydrolase AqdA1 (Xanthobacter sp. DMC5)
MDHEVEYNNRARVPDHPAIFERWAHSSATMRGAAVAADLGVPYGSGPRQILDIIWPGTDR
QAPVVLFIHGGYFQSLHPRDFTFAASGCLAHGVAMAFAGYDLAPLVPVGTILAQTRAAAI
TLYRLVGRPLVVCGHSAGGHLAAALAATSWREIDVDTPDNLIPSGLGISGVYELEPLIPT
SMNKALRLDQEEARRLSPAFWPVPAGRSFDAFVGGAESAEFLRQAHDLAASWRAKGVAAQ
AFGVPGANHFSVVDTLADPSSHMVRRLVEMARAISQ