Protein Info for GFF3817 in Sphingobium sp. HT1-2

Annotation: Multi-sensor hybrid histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF01590: GAF" amino acids 26 to 153 (128 residues), 66.2 bits, see alignment E=6.7e-22 PF13185: GAF_2" amino acids 29 to 153 (125 residues), 39.3 bits, see alignment E=1.2e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 160 to 323 (164 residues), 139.1 bits, see alignment E=5.7e-45 PF00990: GGDEF" amino acids 164 to 319 (156 residues), 120.2 bits, see alignment E=1.1e-38

Best Hits

KEGG orthology group: None (inferred from 72% identity to sch:Sphch_1629)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF3817 Multi-sensor hybrid histidine kinase (Sphingobium sp. HT1-2)
MLDTKLNDEAARLAALGRYEILDTPPEPAFDRITQLVRSILGVPMSVVSLIDGDRQWFKS
RTGIDATETPRDIAFCNHTIRDRVPMVVPDACSDQRFSSNPLVTGDPNIRSYAGVPLATP
DGYNVGTLCAIDTVPREFDPGQIAILENLGALVVEQLELRRIAERDHLSGALTRRAFVAE
MDKHIALFRRYARPASLLLFDIDHFKRVNDSHGHPAGDVVIREVAACCDRTKRPNDILGR
LGGEEFGVLLPESNAAQAGAAAQRFCDAIAALEIAHMPPLRVTASFGIAEIGPDRISSDA
WIAAADVALYAAKHGGRNRVVIAKTDAAQPD