Protein Info for GFF3816 in Sphingobium sp. HT1-2

Annotation: RNA methyltransferase Atu0341

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF22435: MRM3-like_sub_bind" amino acids 10 to 98 (89 residues), 67.9 bits, see alignment E=8.5e-23 PF00588: SpoU_methylase" amino acids 118 to 256 (139 residues), 112.6 bits, see alignment E=1.7e-36

Best Hits

KEGG orthology group: K03437, RNA methyltransferase, TrmH family (inferred from 94% identity to sch:Sphch_1630)

Predicted SEED Role

"FIG011178: rRNA methylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>GFF3816 RNA methyltransferase Atu0341 (Sphingobium sp. HT1-2)
VAREITGFSNPLVKRVRSLREKKYRKAEGLFLAEGLRILTEAREEGVLPEMLFHAGSTHP
LALDLIDAIEADGGDVIETTPDILSKISGKDNAQAVVGVYRDRLTPLEKLDRSTADIWIV
AQSLRDPGNLGTILRTGDAVGAGGLILIDDCVDPFSVESVRASMGALFTQSITQARWGEF
MHWLRQGPGELIGTSLKATQDYQEPSYQSPSFLLVGNEAQGLPESYEAECDQLVKMPMLG
KADSLNAAVATAVMAYELLNQKRRK