Protein Info for GFF3816 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Osmoprotectant ABC transporter ATP-binding subunit YehX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF00005: ABC_tran" amino acids 18 to 162 (145 residues), 116 bits, see alignment E=3.1e-37 PF00571: CBS" amino acids 267 to 306 (40 residues), 23.6 bits, see alignment 8e-09

Best Hits

Swiss-Prot: 88% identical to YEHX_ECOLI: Glycine betaine uptake system ATP-binding protein YehX (yehX) from Escherichia coli (strain K12)

KEGG orthology group: K05847, osmoprotectant transport system ATP-binding protein (inferred from 100% identity to sek:SSPA0647)

MetaCyc: 88% identical to glycine betaine ABC transporter ATP binding subunit YehX (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-283

Predicted SEED Role

"Osmoprotectant ABC transporter ATP-binding subunit YehX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF3816 Osmoprotectant ABC transporter ATP-binding subunit YehX (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIEFNHVSKTFGDQQAVSDLNLHFSEGSFSVLIGTSGSGKSTTLKMINRLVEHDSGTIRF
AGEEIRSLPVLELRRRMGYAIQSIGLFPHWTVAQNIATVPQLQKWSRARINDRIDELMAL
LGLESALRDRYPHQLSGGQQQRVGVARALAADPQVLLMDEPFGALDPVTRGALQQEMTRI
HQLLGRTIVLVTHDIDEALRLADHLVLMDGGHVIQQGSPLSMLTSPENDFVQAFFGRSEL
GVRLLSLRSVGDYVRRHEQLSGDALVEEMTLRDALSMFVARRCDVLPVANQQGEPCGTLH
FRDLLSETSPRETTV