Protein Info for PS417_19530 in Pseudomonas simiae WCS417

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details PF01790: LGT" amino acids 4 to 102 (99 residues), 37.8 bits, see alignment E=2.7e-13 PF08534: Redoxin" amino acids 132 to 254 (123 residues), 68.5 bits, see alignment E=1.2e-22 PF00578: AhpC-TSA" amino acids 133 to 245 (113 residues), 61.7 bits, see alignment E=1.4e-20 PF00085: Thioredoxin" amino acids 157 to 203 (47 residues), 26.4 bits, see alignment 1.2e-09

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU4383)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UII9 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PS417_19530 peroxiredoxin (Pseudomonas simiae WCS417)
MLTLTIGTFAIALNHILLISALILATLVGWRVAKRGGENPESVLFSLFLLGMLVARVSFV
LMYWSDYSQAPLQMVDLRDGGFLAWPGVIALILGALLYGRRRPALRKPLGAGVITGLVFW
GLTSLSLSLYDKGSQLPDITLRNADGDVVQLADYKGGPLVINLWATWCPPCRREMPVLER
AQHQRPDVTFLFVNQAESMQSVSTFLATQGLTLDNILFDASGRLGQAVGSMALPTTLFYQ
ADGRLINSHLGELSQASLARAMEPFDSAPAATRKPTCPASATC