Protein Info for GFF381 in Xanthobacter sp. DMC5

Annotation: Phosphopantetheine adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01510: pantetheine-phosphate adenylyltransferase
  • amino acids 19 to 178 (160 residues), 171 bits, E=1.9e-54
• TIGR00125: cytidyltransferase-like domain
  • amino acids 20 to 72 (53 residues), 57.2 bits, E=1.5e-19
• PF01467: CTP_transf_like
  • amino acids 21 to 154 (134 residues), 67.4 bits, E=7.7e-23

Best Hits

Swiss-Prot: 71% identical to COAD_METRJ: Phosphopantetheine adenylyltransferase (coaD) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 89% identity to xau:Xaut_3787)

MetaCyc: 41% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
• coenzyme A biosynthesis III (archaea) (3/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Protein Sequence (180 amino acids)

>GFF381 Phosphopantetheine adenylyltransferase (Xanthobacter sp. DMC5)
LRDQNRLKTGRMSEHTVRTAIYGGSFDPLTNGHLDVVRSACRLADRLVLAVGIHPGKAPL
FAAEERLAMLREVCGPVAAEENATLEAITFDGLIITTAQRLGATLLIRGLRDGTDLDYEM
QMAGMNGTLAPGIQTVFLPASPRVRPITATLVRQIASMGGDVSAFVPPEVLARLDAKFKR