Protein Info for PS417_19505 in Pseudomonas simiae WCS417

Annotation: 2,4-diaminobutyrate 4-aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 62% identical to RHBA_RHIME: Diaminobutyrate--2-oxoglutarate aminotransferase (rhbA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00836, diaminobutyrate-2-oxoglutarate transaminase [EC: 2.6.1.76] (inferred from 97% identity to pfs:PFLU4378)

MetaCyc: 84% identical to L-2,4-diaminobutyrate:2-ketoglutarate 4-aminotransferase monomer (Pseudomonas aeruginosa PAO1)
Diaminobutyrate--2-oxoglutarate transaminase. [EC: 2.6.1.76]

Predicted SEED Role

"Pyoverdin biosynthesis protein PvdH, L-2,4-diaminobutyrate:2-oxoglutarate aminotransferase (EC 2.6.1.76)" in subsystem Siderophore Pyoverdine (EC 2.6.1.76)

MetaCyc Pathways

pyoverdine I biosynthesis (9/11 steps found)
norspermidine biosynthesis (4/6 steps found)
ectoine biosynthesis (3/5 steps found)
superpathway of polyamine biosynthesis III (5/8 steps found)
ectoine degradation (1/4 steps found)
rhizobactin 1021 biosynthesis (1/7 steps found)
baumannoferrin biosynthesis (1/11 steps found)

KEGG Metabolic Maps

Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UL10 at UniProt or InterPro

Protein Sequence (464 amino acids)

>PS417_19505 2,4-diaminobutyrate 4-aminotransferase (Pseudomonas simiae WCS417)
MSVATSRIEDVQVHETLYQFDETPLLARQRQQESNARSYPRRIPLALKRAKGLYVEDVEG
RRFIDCLAGAGTLALGHNHPVVIEAIQQVLADELPLHTLDLTTPVKDQFVQDLFGLLPPA
LAREAKIQFCGPTGTDAVEAALKLVRTATGRSTVLSFQGGYHGMSQGALSLMGSLGPKKP
LGALLGNGVQFLPYPYDYRCPFGLGGAEGVRVNLHYLDNLLNDPEAGVLLPAAVIVEVVQ
GEGGVIPADLDWLRGLRRITEQAGVALIVDEIQSGFGRTGKLFAFEHAGIIPDVVVMSKA
IGGSLPLAVVVYRDWLDTWLPGAHAGTFRGNQMAMAAGSAVMRYLKDHDLAGHAAAMGER
LGEHLRILQRDFPHLGDIRGRGLMLGVELVDPNGTLDVQGHPPVHRQLAPLVQRECLKRG
LILELGGRHGSVVRFLPPLVITAVEVDLVADIFGRALAAAVASL