Protein Info for PS417_19500 in Pseudomonas simiae WCS417

Annotation: antibiotic synthesis protein MbtH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 74 PF03621: MbtH" amino acids 1 to 53 (53 residues), 88.9 bits, see alignment E=5.7e-30

Best Hits

Swiss-Prot: 47% identical to MBTH_MYCTO: Protein MbtH (mbtH) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K05375, MbtH protein (inferred from 99% identity to pfs:PFLU4377)

MetaCyc: 47% identical to putative conserved protein (Mycobacterium tuberculosis H37Rv)
2.3.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6P0 at UniProt or InterPro

Protein Sequence (74 amino acids)

>PS417_19500 antibiotic synthesis protein MbtH (Pseudomonas simiae WCS417)
MTSVFDRDDILFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGMKKECLAYIEEVWTDMRP
LSLRQKMDGAAVAG