Protein Info for GFF3807 in Xanthobacter sp. DMC5

Annotation: Methanol dehydrogenase [cytochrome c] subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 494 to 511 (18 residues), see Phobius details amino acids 549 to 568 (20 residues), see Phobius details amino acids 580 to 599 (20 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 21 to 558 (538 residues), 784.8 bits, see alignment E=2e-240 PF01011: PQQ" amino acids 37 to 384 (348 residues), 164.5 bits, see alignment E=4.5e-52 amino acids 494 to 550 (57 residues), 41 bits, see alignment 1.1e-14 PF13360: PQQ_2" amino acids 67 to 215 (149 residues), 50.3 bits, see alignment E=2.7e-17 amino acids 475 to 538 (64 residues), 23.1 bits, see alignment E=5.3e-09

Best Hits

Swiss-Prot: 72% identical to XOXF_PARDE: Putative dehydrogenase XoxF (xoxF) from Paracoccus denitrificans

KEGG orthology group: K00114, alcohol dehydrogenase (cytochrome c) [EC: 1.1.2.8] (inferred from 90% identity to xau:Xaut_1781)

Predicted SEED Role

"Methanol dehydrogenase large subunit protein (EC 1.1.99.8)" in subsystem Respiratory dehydrogenases 1 (EC 1.1.99.8)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.8

Use Curated BLAST to search for 1.1.2.8 or 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (601 amino acids)

>GFF3807 Methanol dehydrogenase [cytochrome c] subunit 1 (Xanthobacter sp. DMC5)
MRRLLVLTATAAATAFFGAPASANDSVLKLTQDPNQWVLQTGDYANTRHSKLKQITTDNV
NKLQVSWTFSTGVLRGHEGSPLVVGDIMYVHTPFPNIVYALDLNNEGKIIWKYEPKQDPT
VIPVMCCDTVNRGLAYADGKVFLHQADTKVVALDAKTGKVAWSVVNGDPKKGETNTATVM
PVKDKVLVGISGGEFGVQCHVTAYDINTGKQAWRAYSVGPDSQILFDEKTTALGKPVGKD
SSLATWQGDQWKTGGGCTWGWYSYDPQLNLIYYGSGNPSTWNPKQRPGDNKWSMTIFARD
ADTGVAKWVYQMTPHDQWDFDGINEMILADQQIGGQTRPTLVHFDRNGFGYTLDRKTGEL
LVAEKFDPAVNWATKVDMDKNSPTYGRPLVVDKYSTEKNGEDVNTTGICPAALGTKDQQP
AAFSPDTGLFYVPTNHVCMDYEPFRVSYTPGQPYVGATLSMFPAPGSHGGMGNFIAWDAK
QGKIVWSNPEQFSVWSGALSTAGGVVFYGTLEGYLKAVDAKTGKELYKFKTPSGIIGNVM
TYTHKGKQYVAVLSGVGGWAGIGLAAGLTDPNAGLGAVGGYAALSNYTALGGQLTVFAIP
Q