Protein Info for PS417_19430 in Pseudomonas simiae WCS417
Annotation: ureidoglycolate hydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to ALLA_PSEFS: Ureidoglycolate lyase (allA) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: K01483, ureidoglycolate hydrolase [EC: 3.5.3.19] (inferred from 97% identity to pfs:PFLU4362)MetaCyc: 51% identical to ureidoglycolate lyase (Escherichia coli K-12 substr. MG1655)
Ureidoglycolate lyase. [EC: 4.3.2.3]
Predicted SEED Role
"Ureidoglycolate hydrolase (EC 3.5.3.19)" in subsystem Allantoin Utilization (EC 3.5.3.19)
MetaCyc Pathways
- superpathway of purines degradation in plants (14/18 steps found)
- allantoin degradation to glyoxylate I (2/3 steps found)
- superpathway of allantoin degradation in yeast (4/6 steps found)
- superpathway of allantoin degradation in plants (4/8 steps found)
- allantoin degradation to glyoxylate II (1/5 steps found)
- allantoin degradation to glyoxylate III (1/5 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.3.19 or 4.3.2.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UP84 at UniProt or InterPro
Protein Sequence (167 amino acids)
>PS417_19430 ureidoglycolate hydrolase (Pseudomonas simiae WCS417) MRTLMIEPLTKEAFAPFGDVIETDGSDHFMINNGSTMRFHKLATVETAQPEDHAIISIFR ADAQDMPLTVCMLERHPLGSQAFIPLLGNPFLIVVAPLGDEPVSGLVRAFVTNGRQGINY HRGVWHHPVLTIEKRDDFLVVDRSGTGNNCDEHFFKEDERLILAPHQ