Protein Info for PS417_19410 in Pseudomonas simiae WCS417

Annotation: 5-hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 TIGR02962: hydroxyisourate hydrolase" amino acids 2 to 117 (116 residues), 133.5 bits, see alignment E=2.2e-43 PF00576: Transthyretin" amino acids 4 to 116 (113 residues), 127.7 bits, see alignment E=1.5e-41

Best Hits

Swiss-Prot: 81% identical to HIUH_PSEAE: 5-hydroxyisourate hydrolase (PA1518) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07127, 5-hydroxyisourate hydrolase [EC: 3.5.2.17] (inferred from 98% identity to pfs:PFLU4358)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1S5 at UniProt or InterPro

Protein Sequence (117 amino acids)

>PS417_19410 5-hydroxyisourate hydrolase (Pseudomonas simiae WCS417)
MGRLTTHVLDAAHGCPGSAIKVELYRVEGAQLERVATAVTNSDGRCDAPLLQGDDYRSGV
YQLQFSAGDYYRARGVQLPEPAFLDVVVLRFGISAEQDHYHVPLLISPYSYSTYRGS