Protein Info for GFF379 in Xanthobacter sp. DMC5

Annotation: Thiol:disulfide interchange protein DsbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 128 to 156 (29 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details PF02683: DsbD_TM" amino acids 5 to 193 (189 residues), 58.9 bits, see alignment E=2.3e-20

Best Hits

KEGG orthology group: K06196, cytochrome c-type biogenesis protein (inferred from 91% identity to xau:Xaut_3785)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcdA (DsbD analog)" in subsystem Biogenesis of c-type cytochromes or Experimental tye or Periplasmic disulfide interchange or Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF379 Thiol:disulfide interchange protein DsbD (Xanthobacter sp. DMC5)
MADVTLPAAFLAGLASFVSPCVLPLVPPYLCFLGGSTLEDLAGAEPVKEVERRALVGAAL
FVSGFSVVFVALGAGASAIGDVLRAHLDVLSIIAGLAIIVMGLNFLGVFRIHLLHRTARP
HVQAPAGLWGAFVMGLAFAFGWTPCLGPVLGAILAVAGSEATVSKGAGLLAVYSLGLGVP
FLAAAFAVRPFLRGLVHMRKMLPVVEKAMGALLVLTGIAFMSGWIAHVSYWLIETFPSLS
TIG