Protein Info for GFF379 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Arginase (EC 3.5.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00491: Arginase
  • amino acids 3 to 296 (294 residues), 256.4 bits, E=1.8e-80
• TIGR01229: arginase
  • amino acids 6 to 300 (295 residues), 290.6 bits, E=7.1e-91

Best Hits

KEGG orthology group: K01476, arginase [EC: 3.5.3.1] (inferred from 82% identity to mpt:Mpe_A1081)

Predicted SEED Role

"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• superpathway of putrescine biosynthesis (4/4 steps found)
• L-arginine degradation VII (arginase 3 pathway) (2/2 steps found)
• putrescine biosynthesis III (2/2 steps found)
• urea cycle (4/5 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of polyamine biosynthesis I (6/8 steps found)
• L-arginine degradation VI (arginase 2 pathway) (3/4 steps found)
• L-arginine degradation I (arginase pathway) (2/3 steps found)
• L-canavanine degradation I (1/2 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-N^δ-acetylornithine biosynthesis (4/7 steps found)
• superpathway of polyamine biosynthesis II (4/8 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.1

Protein Sequence (305 amino acids)

>GFF379 Arginase (EC 3.5.3.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQKDVSLIGVPTDIGAGARGASMGPEALRVAGLATVLEGQGLSVADRGNLGGPANPWLPP
TEGYRHLQEVVAWNQSLHEAVHAELALGRLPIVLGGDHCLGLGSISAVARHCREARKKLR
VLWLDAHADFNTAALTPSGNIHGMPVALLCGMGPPELTGIGGTTPAIDASVVRQIGIRSV
DAGEKRLVHQAGLEVFDMRYIDEMGMRHTMEQALMGVDEQTHLHVSFDVDFLDPEIAPGV
GTTVLGGPTYREAQLCMEMIADTGRLCSLDVMELNPALDVRNRTAVLAVDLIESLFGKST
LMRKN