Protein Info for GFF3788 in Xanthobacter sp. DMC5

Annotation: Peptidoglycan O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details amino acids 435 to 459 (25 residues), see Phobius details PF03062: MBOAT" amino acids 141 to 343 (203 residues), 94.8 bits, see alignment E=3.3e-31

Best Hits

KEGG orthology group: None (inferred from 87% identity to xau:Xaut_1751)

Predicted SEED Role

"Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)" in subsystem Alginate metabolism (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>GFF3788 Peptidoglycan O-acetyltransferase (Xanthobacter sp. DMC5)
MVFASDSFLFLFLPVFLIVYALTPGMARNLAILAFSWLFYAWWRADFLPLIVSIAMWSWA
TGLWISRAEGRARGWALFIGIVWPLASLVWFKYANMLVHSTEVLTASVWGWPDVLLPIGL
SFFVFGAISYSTDVFRGTVKAEPSFVNYATYQSMFGHLVAGPVVRYEWVAQRLKERTFHR
AEFMFGVERFMLGFAQKVLIADTLAPLVDAGYAIAHPTTADVVLAVTGYTLQLYFDFSGY
SAMAIGLGLMVGLKFPENFDNPYLSTSLSEFWRRWHISLSSWLRDYLYISLGGNRGSTTR
VSTNLLITMGLGGLWHGASWTFLIWGLWHGFGLMVGRVWKNLRLPGTGAFAGHILTLAFV
MVGWALFRAQSWAEAGVIFSGLAGTNGVALSPAMGAAIRPVEIATIGLGIGLVYLPKLMR
IDPSAPNPGHWLRAWAALPLFLFAVLVLQGRMVVPFLYFQF