Protein Info for GFF3785 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: GTP cyclohydrolase I (EC 3.5.4.16) type 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR00063: GTP cyclohydrolase I" amino acids 40 to 220 (181 residues), 284.6 bits, see alignment E=1.3e-89 PF01227: GTP_cyclohydroI" amino acids 41 to 218 (178 residues), 205.9 bits, see alignment E=1.7e-65

Best Hits

Swiss-Prot: 100% identical to GCH1_SALSV: GTP cyclohydrolase 1 (folE) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 100% identity to seg:SG2230)

MetaCyc: 96% identical to GTP cyclohydrolase 1 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>GFF3785 GTP cyclohydrolase I (EC 3.5.4.16) type 1 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPSLSKEAALVHDALVARGLETPLRPPMDELDNETRKSLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHP