Protein Info for GFF3783 in Xanthobacter sp. DMC5

Annotation: Nitrogen fixation regulation protein FixK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00027: cNMP_binding" amino acids 58 to 133 (76 residues), 54.9 bits, see alignment E=1.1e-18 PF13545: HTH_Crp_2" amino acids 173 to 249 (77 residues), 64.6 bits, see alignment E=9.6e-22 PF00325: Crp" amino acids 199 to 226 (28 residues), 56.2 bits, see alignment (E = 3.2e-19)

Best Hits

Swiss-Prot: 63% identical to FIXK_AZOC5: Nitrogen fixation regulation protein FixK (fixK) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 82% identity to xau:Xaut_1746)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>GFF3783 Nitrogen fixation regulation protein FixK (Xanthobacter sp. DMC5)
MPSPAAAIAHKTYAQPRAYDSKSFAEPLSSARPAHRWTEEADTRTPTEVVARLGVVASYA
RNAEIFGEDQPAENLYIVLSGAVRICKLLGDGRRQIETFCLPGDVFGWEMTGRHRFSAEA
VSECKIVRVKRSILFSRASDDAELAHALWALTAAELGRAQDHLLVLGRKTAQERVATFLL
DMAERAGAGQGPNGVEVTLPMSRQDIADFLGLTIETVSRTLTHLEEISAIALPSSRRVVL
RDGATLKRLNS