Protein Info for GFF3776 in Sphingobium sp. HT1-2

Annotation: FIG005935: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 33 to 58 (26 residues), see Phobius details amino acids 64 to 80 (17 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details PF01027: Bax1-I" amino acids 23 to 231 (209 residues), 197.5 bits, see alignment E=1.1e-62

Best Hits

KEGG orthology group: K06890, (no description) (inferred from 94% identity to sjp:SJA_C1-33270)

Predicted SEED Role

"FIG005935: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>GFF3776 FIG005935: membrane protein (Sphingobium sp. HT1-2)
VNNPVRMPGYGASQTAQTDAGLRAHMLGVFRNMGIGLVITGLVAALVGNTPVLAAAIFGT
PLKWVAIFAPLAFVFFFSFRIDKMTTAGARTAFYAFAAVMGVSLGSVFLVFTGGSIAQAF
FSAAVMFLAMALWGYTTQRDLTKMGSFLMMGLIGIVVASLINIFIGSSAMAMVISIIGVV
VFTGLTAWDVQRIKSEYFYYAGHEVAQKMQVMGALSLYLNFVNLFQMLLSLTGERE