Protein Info for PS417_19320 in Pseudomonas simiae WCS417

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF12146: Hydrolase_4" amino acids 79 to 172 (94 residues), 34.7 bits, see alignment E=1.2e-12 PF12697: Abhydrolase_6" amino acids 80 to 282 (203 residues), 41.3 bits, see alignment E=3e-14

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 97% identity to pfs:PFLU4339)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TRX7 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PS417_19320 alpha/beta hydrolase (Pseudomonas simiae WCS417)
MMLRVLLLTLTLFSSLGFAASPVVLQRPISLDTGSGELFGSLLLPKSEEPVPVVLIIAGS
GPTDRNGNSADGARNDSLKRLAWVLARHNIASVRYDKRGVAASLAATPDERNLTLDAYVA
DAVAWGKLLKADKRMGPLIVLGHSEGALVAALAAPQLDPAGVVSLSGSARPVDQVIRQQL
ADHLPPALLLRSNQILDHLKAGQVDADVPGPLEGIFRPSVQPYLISLFRADPSAAFAKLN
MPALIIQGTHDIQVGVGDAQQLKKAKPDAQLAVIEGMNHVMRIVPNDVKQQLASYNDPQR
PLAAELGNRLVRFIDGLQPR