Protein Info for GFF3773 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 232 to 255 (24 residues), see Phobius details amino acids 265 to 290 (26 residues), see Phobius details amino acids 302 to 328 (27 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 426 to 450 (25 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details amino acids 488 to 510 (23 residues), see Phobius details amino acids 518 to 550 (33 residues), see Phobius details TIGR00829: PTS system, Fru family, IIB component" amino acids 106 to 189 (84 residues), 129.1 bits, see alignment E=5.9e-42 PF02302: PTS_IIB" amino acids 106 to 195 (90 residues), 72.5 bits, see alignment E=3.7e-24 TIGR01427: PTS system, Fru family, IIC component" amino acids 214 to 551 (338 residues), 492 bits, see alignment E=1.1e-151 PF02378: PTS_EIIC" amino acids 232 to 495 (264 residues), 73.7 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 93% identical to PTFBC_ECOLI: PTS system fructose-specific EIIB'BC component (fruA) from Escherichia coli (strain K12)

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 99% identity to set:SEN2197)

MetaCyc: 93% identical to fructose-specific PTS multiphosphoryl transfer protein FruA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (562 amino acids)

>GFF3773 PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKTLLIIDANLGQARAYMAKTLLGAAAHKANLEIIDNPNDAELAIVLGESLPNDNALNGK
KVWLGDIGRAVAHPELFLSEAKSHATPYSAPAAAVPAASGGPKRVVAVTACPTGVAHTFM
AAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAEADLVIVAADIEVDLAKFAGLPMY
RTSTGLALKKTAQELDKAVAEATPYQPAGKASQAATEGKKESAGAYRHLLTGVSYMLPMV
VAGGLCIALSFAFGIEAFKVPDTLAAALMQIGGGSAFALMVPVLAGYIAFSIADRPGLTP
GLIGGMLAVSTGSGFIGGIIAGFLAGYMAKLISTKLKLPQSMEALKPILIIPLISSLVVG
LAMIYLIGKPVAGILEGLTHWLQTMGTVNAVLLGAILGGMMCTDMGGPVNKAAYAFGVGL
LSTQTYAPMAAIMAAGMVPPLALGLATMVARRKFDKAQQEGGKAALVLGLCFITEGAIPF
AARDPMRVLPCCIVGGALTGAISMAVGAKLMAPHGGLFVLLIPGAITPVLGYLLAIVAGT
LVAGLAYAVLKRPETEVTAKAA