Protein Info for GFF377 in Sphingobium sp. HT1-2

Annotation: Protein-export protein SecB (maintains pre-export unfolded state)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02556: SecB
  • amino acids 18 to 155 (138 residues), 175.2 bits, E=3.5e-56
• TIGR00809: protein-export chaperone SecB
  • amino acids 19 to 153 (135 residues), 134.3 bits, E=1.4e-43

Best Hits

Swiss-Prot: 62% identical to SECB_SPHAL: Protein-export protein SecB (secB) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 87% identity to sjp:SJA_C1-08290)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Protein Sequence (167 amino acids)

>GFF377 Protein-export protein SecB (maintains pre-export unfolded state) (Sphingobium sp. HT1-2)
MADEADTIQTNVTGNGADTAPQIALISQYVKDLSFENPNAPSVYQWQDQPQIDVQFNIGA
DRVGDEVLEIALKIEVKAVAPQGTAFAVELVYAALFGMRNVPEDQIQPFMLAEAPRLVFP
FARRVLADAIRDGGFPPLLLDPIDFGALYLQQAEQMQQTAGEPAGHA