Protein Info for GFF3769 in Xanthobacter sp. DMC5

Annotation: D-beta-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 107 to 126 (20 residues), see Phobius details PF00106: adh_short" amino acids 5 to 197 (193 residues), 179.8 bits, see alignment E=8.7e-57 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 5 to 260 (256 residues), 374.7 bits, see alignment E=9.9e-117 PF08659: KR" amino acids 8 to 165 (158 residues), 24.6 bits, see alignment E=4.5e-09 PF23441: SDR" amino acids 9 to 256 (248 residues), 29.8 bits, see alignment E=8e-11 PF13561: adh_short_C2" amino acids 13 to 257 (245 residues), 180.9 bits, see alignment E=6.4e-57

Best Hits

Swiss-Prot: 49% identical to YXJF_BACSU: Uncharacterized oxidoreductase YxjF (yxjF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 94% identity to xau:Xaut_1887)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF3769 D-beta-hydroxybutyrate dehydrogenase (Xanthobacter sp. DMC5)
MLKGKVAVVTGSTSGIGLAYARAFAKEGVNVVINGLGDAAAIEKERSAIESEFGVKALYS
PANMLKADEIADMVKLAETELGACDILVNNAGIQHVAPIEEFPIDTWNTIIAINLSAAFF
AMRAAIPGMKARKWGRIINTASAHALVASPFKSAYVSAKHGIAGLTKTAALETATFGITV
NAICPGYVWTPLVEKQIPDTAKARGMTEEEVKKNVLLAAQPTKEFVTVEEVAALAVFLAS
DNARSITGSMQQIDGGWVAE