Protein Info for GFF3765 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 101 to 122 (22 residues), see Phobius details amino acids 164 to 209 (46 residues), see Phobius details amino acids 221 to 222 (2 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details PF28475: DUF8413" amino acids 6 to 75 (70 residues), 58.7 bits, see alignment E=4.8e-20 PF01944: SpoIIM" amino acids 107 to 286 (180 residues), 131 bits, see alignment E=4.2e-42

Best Hits

KEGG orthology group: None (inferred from 48% identity to pmy:Pmen_3317)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF3765 no description (Variovorax sp. SCN45)
MTPLDFEAAYAPLWTELEAVIGAAETKRKFDGARLATLYRRVCEHLALAQARAYPIHLTQ
RLESLTQSAHRLIYRQHDYGLGRFARLALIDFPEAVRAHRVYLWVSALMFVVPLLVAGWA
AWRDPGFILHLLDADNVQQFDAMYSDDADAFGRTRSAGDDWQMFGFYVMHNIGIGFRCFA
AGIFAGVGSAALVVFNGIQIGAVGGYLISAGHAQNFLSFVVTHSAFELTAIVLAGAAGLR
LGYAWIAPGRHTRLEALRLAARHAVVIVYGVIGLLLIAAAVEAFWSSARWIAPAVKYGVG
GACWVLVLAYLGWQGRPRGGAEAAAPKESGHAG