Protein Info for GFF3764 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Translation elongation factor P-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR02178: elongation factor P-like protein YeiP" amino acids 3 to 189 (187 residues), 335.7 bits, see alignment E=4.9e-105 PF08207: EFP_N" amino acids 4 to 62 (59 residues), 57.3 bits, see alignment E=1.9e-19 PF01132: EFP" amino acids 72 to 124 (53 residues), 51 bits, see alignment E=1.7e-17 PF09285: Elong-fact-P_C" amino acids 133 to 188 (56 residues), 73.1 bits, see alignment E=1.8e-24

Best Hits

Swiss-Prot: 100% identical to EFPL_SALPK: Elongation factor P-like protein (yeiP) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K02356, elongation factor P (inferred from 98% identity to eco:b2171)

Predicted SEED Role

"Translation elongation factor P-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>GFF3764 Translation elongation factor P-related protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPRANEIKKGMVLNYNGKLLIVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDD
IVDTVTLSRRGVDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTW
DGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGLVIQVPEYLSAGEKIRIHI
EERRYMGRAD