Protein Info for GFF3762 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 22 to 53 (32 residues), see Phobius details amino acids 70 to 86 (17 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details PF04632: FUSC" amino acids 24 to 336 (313 residues), 52.4 bits, see alignment E=7.6e-18 PF06081: ArAE_1" amino acids 26 to 160 (135 residues), 24.6 bits, see alignment E=4.9e-09 PF13515: FUSC_2" amino acids 31 to 156 (126 residues), 65.9 bits, see alignment E=7.9e-22 PF11744: ALMT" amino acids 44 to 186 (143 residues), 32.2 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: None (inferred from 64% identity to vap:Vapar_4804)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF3762 hypothetical protein (Variovorax sp. SCN45)
MNAAPALQHFTGLWRHGRWRPGVQLAGAVALAWIVSVALHLPESFWAVMSVLIVMRPSAG
STLDAGWDRVRGTAAGALCGLAGVYLQHHGVPVLPVTLAVVMLLAFAGAAVPGLRSAPVA
ALIILSAGGIPGHSALQVAVLRMVQIGIGVGVALAVSTVMSEYHAGARFDEGCAALLRGI
AKRMAGTPRPADAEKERIDAGTRAALGRLALLAGSADLEARWWRRGATAGTSRTYRNRAR
LAARIFQDAVVLDRVLRLAKGDEAADPFRQDAARAAGKAIAGMADALAGTVVSPDLAELD
RCAQAAHGTLPNAMLAAPLNLLLDDLRHLQRTLEPARQGPPGPG