Protein Info for PS417_19240 in Pseudomonas simiae WCS417

Annotation: peptidase M42

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR03106: hydrolase, peptidase M42 family" amino acids 9 to 350 (342 residues), 584.3 bits, see alignment E=3.4e-180 PF05343: Peptidase_M42" amino acids 54 to 342 (289 residues), 240.8 bits, see alignment E=1.7e-75 PF01546: Peptidase_M20" amino acids 157 to 253 (97 residues), 30.9 bits, see alignment E=2.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4322)

Predicted SEED Role

"Deblocking aminopeptidase (EC 3.4.11.-) @ Cyanophycinase 2 (EC 3.4.15.6)" (EC 3.4.11.-, EC 3.4.15.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.- or 3.4.15.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKW5 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PS417_19240 peptidase M42 (Pseudomonas simiae WCS417)
MSRTIPEPDLNYLQKVLLEMLAIPSPTGFTDTIVRYVAERLEELGIPFEMTRRGTIRATL
KGQKNSPDRAVSAHLDTIGAAVRAIKDNGRLSLAPVGCWSSRFAEGSRVSLFTDNGVIRG
SVLPLMASGHAFNTAVDEMPVSWDHVELRLDAYCATRADCDSLGIGIGDYVAFDPLPEFT
ESGHISARHLDDKAGVAALLAALKAIVDSGEPLLIDCHPLFTITEETGSGAAAALPWDVS
EFVGIDIAPVAPGQHSSEHAVSVAMQDSGGPYDYHLSRHLLRLASDNELPVRRDLFRYYF
SDAHSAVTAGHDIRTALLAFGCDATHGYERTHIDSLAALSRLLGAYILSPPVFASDAQPA
QGSLDRFSHQIEHETQMESDTRVPSVDSLVGNKS