Protein Info for GFF3754 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 108 to 135 (28 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 193 to 220 (28 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 68% identity to sjp:SJA_C1-30570)

Predicted SEED Role

"FIG01094667: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF3754 hypothetical protein (Sphingobium sp. HT1-2)
MAAVSIGKAWEEAVAFVAREASLLFPVALLFLALPGLILQEMTPPQLAEWMANPQRTGLP
DIPPGFALAMLLGVVIIWFGSLTLFALALRPGISVGEALRLGFARLPVLLGTALLAMFLI
GGLMLAAILVAVLASLVSESVGTSIGAILGAFVGGATIFASVRLMLLNPAVIDGNQGVVP
SLRHAWALTRGCFWRLLGFIILITLLSGIASMAAQTIFGALAGLAAGPEAARLVGGVASA
AVSTVIQVYMLVMLARIYRQASAG