Protein Info for GFF3751 in Variovorax sp. SCN45

Annotation: Hydroxymethylpyrimidine ABC transporter, transmembrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 10 to 17 (8 residues), see Phobius details amino acids 29 to 33 (5 residues), see Phobius details transmembrane" amino acids 18 to 28 (11 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 188 to 204 (17 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 249 (169 residues), 96.8 bits, see alignment E=6.9e-32

Best Hits

Swiss-Prot: 34% identical to RIBX_CHLAA: Riboflavin transport system permease protein RibX (ribX) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 54% identity to bur:Bcep18194_C7650)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF3751 Hydroxymethylpyrimidine ABC transporter, transmembrane component (Variovorax sp. SCN45)
MNQPVPRSEAWRRFIDPALLFIVLAVLWEKSVDVFGIKRYLLPPLSQVLDSLWSNRMALL
AQSWVTTQEVLAGFALAAIGGVLLGLAIHAVPVVRRMLYPLIVVFQGLPKIALAPLMVIW
FGYGDTSKILMAFLFAFFPVVIATMGGLAGTPAHLVEHFRAIRAPAWTTFRRLYVPSALP
SIMDGCKSAMPLAVIGAIVGEFVGSERGLGHLILEANANARTDYLFAALVVISAVAGLLY
VLVELAAKRVWWRGL