Protein Info for GFF3749 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 827 transmembrane" amino acids 50 to 72 (23 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details PF13491: FtsK_4TM" amino acids 44 to 198 (155 residues), 72.9 bits, see alignment E=5.2e-24 PF17854: FtsK_alpha" amino acids 328 to 427 (100 residues), 97.5 bits, see alignment E=9e-32 PF01580: FtsK_SpoIIIE" amino acids 435 to 654 (220 residues), 250.3 bits, see alignment E=3.1e-78 PF09397: FtsK_gamma" amino acids 764 to 821 (58 residues), 88.5 bits, see alignment 4.1e-29

Best Hits

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 82% identity to xau:Xaut_1841)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (827 amino acids)

>GFF3749 hypothetical protein (Xanthobacter sp. DMC5)
MPMARRRPKAAATADAVINSRMDAPHHHMPRIELIPESIRLVVRRRGREIVGTGLILATL
ISFVALGTWSAVDPSLSNATHAPVTNLLGRPGAIIADLLVQLFGLAALAVLLPPLYAGWR
LVTHRPFARERLRITCWLIGVLGTTAFLGAIPQPDHWPGLTGLGGALGDLFPRAFGVMRG
GALAALDSMLIGAAGLAIGAAGLFFALSGGRRTPLKLAPASELPGEVGDEDEEDDGTAVS
LGALTHTFLSWKARLSGAGLARRAMPAPAASAGPAEGSGQRQEPRLEGASAPAPHDVPDA
PLDAASESPAARRRAARRGGRRAGYQHPSLELLTPAPPARAPAMSPEALSETARELEATL
QDFGVRGEIGQVRPGPVVTLYELEPAPGIKSSRVIGLADDIARSMSAISARVAVVPGRNA
IGIELPNQKRDKVLLRELIATKDFGDTGHKLAIALGKTIGGDPVIVDLARMPHLLVAGTT
GSGKSVAINTMILSLLYRLKPEQCRLIMVDPKMLELSVYDGIPHLLAPVVTDPKKAVVAL
KWAVKEMEDRYKKMSKLGVRNIDGFNARVKDASEKGESIARTVQTGFDHETGEAIYEREE
MNLEPLPYIVVIVDEMADLMLVAGKDIEGAIQRLAQMARAAGIHLVMATQRPSVDVITGT
IKANFPTRISFQVTSKIDSRTILGEMGAEQLLGQGDMLYMAGGGRISRVHGPFVSDEEVE
SVVKYLKAQGAPAYVEAVTAEDAEDEDGDGAVFDKSGMGDEGMDLYSQAVAVVMRDRKCS
TSYIQRRLQIGYNRAASLVERMEKEGLVGSPNHAGKREILLPEQAAE