Protein Info for GFF3747 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG001881: hydrolase of alkaline phosphatase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 51 to 76 (26 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details PF11893: DUF3413" amino acids 6 to 252 (247 residues), 357.5 bits, see alignment E=4.7e-111 PF00884: Sulfatase" amino acids 260 to 501 (242 residues), 124.1 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 100% identical to YEJM_SALTY: Inner membrane protein YejM (yejM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07014, (no description) (inferred from 100% identity to seg:SG2266)

Predicted SEED Role

"FIG001881: hydrolase of alkaline phosphatase superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (586 amino acids)

>GFF3747 FIG001881: hydrolase of alkaline phosphatase superfamily (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVTHRQRYREKVSQMVSWGHWFALFNILLATLLGSRYLFVADWPTTLAGRIYSYLSIVGH
FSFLVFATYLLILFPLTFIVMSQRLMRFLSAILATAGMTLLLIDSEVFTRFHLHLNPIVW
ELVINPDQNEMARDWQLMFISVPVILLIEMLFATWSWQKLRSLTRRRHFARPLAAFFFVS
FIASHLIYIWADANFYRPITMQRANLPLSYPMTARRFLEKHGLLDAQEYQRRLVEQGNPE
AVSVQYPLSNLHYRDMGTGQNVLLITVDGLNYSRFEKQMPELATFAEQNIDFTRHMSSGN
TTDNGIFGLFYGISPGYMDGVLSTRTPAALITALNQQGYQLGLFSSDGFASPLYRQALLS
DFSMPAAQTQSDAQTASQWIDWLGRYAQEDNRWFSWISFNGTNIDDSNQKNFVKRYASAA
SDVDAQINRVLNALREAGKFDNTVVIITAGRGIPLTPEENRFDWSQGHLQVPLVIHWPGT
PAQRINVLTDHTDVMTTLMQRLLHVSTPANEYSQGQDIFTVPRRHNWVTAADGSTLAITT
PQMTLVLNNNGHYQTYDLHGEKIKDQKPQLSLLLQVLTEEKRFIAN