Protein Info for GFF3746 in Variovorax sp. SCN45

Annotation: Probable NADH dehydrogenase/NAD(P)H nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 13 to 158 (146 residues), 45.2 bits, E=6e-16

Best Hits

Swiss-Prot: 59% identical to Y1586_CUPNJ: Putative NADH dehydrogenase/NAD(P)H nitroreductase Reut_A1586 (Reut_A1586) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 59% identity to reu:Reut_A1586)

MetaCyc: 60% identical to FAD reductase (NADH) (Cupriavidus nantongensis)
RXN-8506 [EC: 1.5.1.37]

Predicted SEED Role

"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.5.1.37

Protein Sequence (196 amino acids)

>GFF3746 Probable NADH dehydrogenase/NAD(P)H nitroreductase (Variovorax sp. SCN45)
MISDSALDTLFRQARSHNGWLPRPVSEAQLRQVYELVKWGPTSANCSPMRVLFVRTDEGR
ERLRPLLSPGNVEKTMTAPVTAIIGFDTEFHRELPRLFPHNPTMREHFTAPGKEAHAALT
AFRNASLQAGYFILAARAVGLDCGPMSGFDTEAVDRVFWGGTTVKTNFLCNLGHGDAALL
FGRHPRLAFDEACGFA