Protein Info for GFF3746 in Sphingobium sp. HT1-2

Annotation: Ornithine carbamoyltransferase (EC 2.1.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 3 to 148 (146 residues), 157.1 bits, E=3.4e-50
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 3 to 305 (303 residues), 364.3 bits, E=2.4e-113
• PF00185: OTCace
  • amino acids 155 to 303 (149 residues), 178.1 bits, E=1.3e-56

Best Hits

Swiss-Prot: 76% identical to OTC_NOVAD: Ornithine carbamoyltransferase (argF) from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)

KEGG orthology group: None (inferred from 89% identity to sch:Sphch_2663)

MetaCyc: 54% identical to ArgF (Bacillus subtilis)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (308 amino acids)

>GFF3746 Ornithine carbamoyltransferase (EC 2.1.3.3) (Sphingobium sp. HT1-2)
MTKHFLNLTDAGGDAIAAMIADAIDRKAARAGKPKGWVDADAPLAGHTLAMIFEKNSTRT
RVSFDMAIRQLGGNSLILDGATSQLGRGETVADTARVLSRMADAIMIRTDDHAKIEEMAE
YASVPVINGLTDLSHPCQIVADLLTMVEHGLALPGSQWAWLGDGNNVLHSIVEAAGLMNF
DVRMGIPEGYDPDPSFAAAAQAAGSTITLTRDAAQAVAGADVVVTDTWISMGQAHAEAKL
AAMMPYQVTPELMAGAKADAKFLHCLPAHRGEEVVEAVIDGPQSLIWDEAENRIHAQKSV
LLWALGKL