Protein Info for GFF3741 in Xanthobacter sp. DMC5

Annotation: tRNA modification GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF10396: TrmE_N" amino acids 9 to 124 (116 residues), 110 bits, see alignment E=1.7e-35 PF12631: MnmE_helical" amino acids 127 to 433 (307 residues), 138 bits, see alignment E=9.8e-44 PF02421: FeoB_N" amino acids 223 to 309 (87 residues), 31.9 bits, see alignment E=1.8e-11 TIGR00231: small GTP-binding protein domain" amino acids 223 to 308 (86 residues), 53.3 bits, see alignment E=1.4e-18 PF01926: MMR_HSR1" amino acids 224 to 310 (87 residues), 75.3 bits, see alignment E=8.6e-25

Best Hits

Swiss-Prot: 68% identical to MNME_AZOC5: tRNA modification GTPase MnmE (mnmE) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 77% identity to xau:Xaut_1833)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>GFF3741 tRNA modification GTPase MnmE (Xanthobacter sp. DMC5)
MSGETASDTIFALSSGRLPAGVAVLRLSGPEAGVAALALSGALPPPRMARYSALHHPATG
EELDRGLVLFFPGPASATGEDVVELHLHGGRAVVAAVLRALGSLPGLRPAGAGEFTRRAH
ANGKLDLAEVEGLADLIAAETEAQRRQAMALASGTLSRRVTGWRDGLVSALALLEAGIDF
SDEADVAEDVARPALDIIGGLHRELFAALVDAERGERVRDGLVVAIAGPPNAGKSSLLNR
LAGRDAAIVSPIAGTTRDVLEVHLELAGQAVTLLDTAGLRETADAVEAEGVRRALARAEV
ADAVLWLSDEGTSPPAAFAAAICVRTKIDQGGTVPEGFIGLSAVTGEGIEDVVAAIAARA
EVLCGREPALVTRERQRLALEDAARHLERAMGDHGGHEELRAEDVRLAVRALDQTIGRVD
VEDVLDRLFGTFCIGK