Protein Info for GFF374 in Sphingobium sp. HT1-2

Annotation: Tryptophanyl-tRNA synthetase (EC 6.1.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00579: tRNA-synt_1b" amino acids 1 to 286 (286 residues), 242.9 bits, see alignment E=2.4e-76 TIGR00233: tryptophan--tRNA ligase" amino acids 2 to 332 (331 residues), 324.7 bits, see alignment E=3.5e-101

Best Hits

Swiss-Prot: 60% identical to SYW_CAUVC: Tryptophan--tRNA ligase (trpS) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01867, tryptophanyl-tRNA synthetase [EC: 6.1.1.2] (inferred from 91% identity to sjp:SJA_C1-08270)

Predicted SEED Role

"Tryptophanyl-tRNA synthetase (EC 6.1.1.2)" (EC 6.1.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>GFF374 Tryptophanyl-tRNA synthetase (EC 6.1.1.2) (Sphingobium sp. HT1-2)
MRVLSGIQPTGNLHLGNYLGAIRNWVRMQDEMAEGSQCFFFLADMHSITVHEGREQRIRN
VRDMAAALVASGIDPDRSVLFNQARVPAHAELAWLLNGTARIGWLNRMTQFKDKAGKDRE
GASVGLFVYPVLQAADILLYQATHVPVGEDQKQHLELSRDIATKFNTDFGVDVFTLPAPI
IPKESARIMSLRDGTAKMSKSDPSDMSRINLTDEDDAIMTKVKKAKTDPEPLPETAEGLA
GRPEATNLIGIYATLSNSTPDAVCAQFAGKGFGAFKPALGELLVETLRPMRERFVELRTD
DAALDAILDKGAAKAAAVAEPTLRAAYDAMGLMR