Protein Info for GFF3738 in Sphingobium sp. HT1-2

Annotation: Flagellar biosynthesis protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 61 to 91 (31 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 202 to 228 (27 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 64 to 260 (197 residues), 279.4 bits, see alignment E=7.9e-88 PF00813: FliP" amino acids 64 to 256 (193 residues), 273.2 bits, see alignment E=6.8e-86

Best Hits

Swiss-Prot: 58% identical to FLIP_PSEAE: Flagellar biosynthetic protein FliP (fliP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 91% identity to sjp:SJA_C1-30730)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF3738 Flagellar biosynthesis protein FliP (Sphingobium sp. HT1-2)
VRASHWLVGGILLTAGLMLVDPALAQAVPAAPAPVDNGGALTRAMGQISGDGRSLSLSLQ
ILVLMSLLSVLPSLILMMTSFTRIIIVLSLLRQALGLQQTPPNQVLVGLALFLSLFVMRP
VIDQINGQAYDPYGKGQISIEEAIGRSGKVLHGFMAKQTRESDLKLFANMAEAPAFRTPD
DIPFTILLPAFVTSELKTAFQIGFMIFLPFLIIDLVVASTLMALGMMMLSPTIISMPFKL
LLFVLVDGWALTMGSLAGSFAT