Protein Info for GFF3737 in Variovorax sp. SCN45

Annotation: DnaA initiator-associating protein DiaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF13580: SIS_2" amino acids 24 to 145 (122 residues), 92.5 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 96% identity to vpe:Varpa_5478)

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF3737 DnaA initiator-associating protein DiaA (Variovorax sp. SCN45)
MLEQRIQQHFIDSADLKYQTGPVLSKPISQAMQAILACVTSGGKVLACGAGVSGLLAAQF
AAQFVGRFERERPELGAIALPGDTTDPNADSASAIDADRFARQVRALGQAGDVLLALSAS
GQSAAVLAAVTAAHERDMTVVALLGNAVSGAPSAPGAGGSGTGGVIGRALRETDVQISVP
HERAARIHEVHLLALHCLCDGVDAQLLGEQEVSP