Protein Info for GFF3735 in Variovorax sp. SCN45

Annotation: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00590: TP_methylase" amino acids 29 to 234 (206 residues), 112.2 bits, see alignment E=3.5e-36 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 30 to 306 (277 residues), 218.1 bits, see alignment E=8e-69 PF23016: RsmI_C" amino acids 266 to 308 (43 residues), 63.1 bits, see alignment 1.7e-21

Best Hits

Swiss-Prot: 44% identical to RSMI_RHILO: Ribosomal RNA small subunit methyltransferase I (rsmI) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K07056, (no description) (inferred from 94% identity to vpe:Varpa_5480)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF3735 16S rRNA (cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198) (Variovorax sp. SCN45)
LASLAPASFGAALAAAHDAAGAQHYPQGTLYVVATPIGNLADITLRALHVLQLVDAIACE
DTRHTQSLLRAYGIDRPGARLLAVHQHNEAEAAQTVVARLAQGERIAYVSDAGTPGVSDP
GARLAAAVRAAGQRVLPLPGASSVTTLVGAAGLVADGGDGNASSAFVFAGFLPSKAGERD
TAVQALSQEPRAVVLLEAPHRIESLARALATLGERRITVGRELTKQFEEIATVAASALPD
WFGADRDRTRGEFALVLHPVAVSGDGGAEGERVLRLLLEELPVKTAVKLAAEISGSPRNT
LYELALRIRNGAEET