Protein Info for GFF373 in Xanthobacter sp. DMC5

Annotation: Cobalamin biosynthesis protein CobD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 303 to 320 (18 residues), see Phobius details TIGR00380: cobalamin biosynthesis protein CobD" amino acids 5 to 299 (295 residues), 204.5 bits, see alignment E=1.1e-64 PF03186: CobD_Cbib" amino acids 7 to 299 (293 residues), 302 bits, see alignment E=2e-94

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 82% identity to xau:Xaut_3779)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>GFF373 Cobalamin biosynthesis protein CobD (Xanthobacter sp. DMC5)
MAFNVAALAVLFEVLLGYPAALVRRIGHPVIWIGRLILFLDRRLNRPGFAPGRRRLMGVV
TVVLVLAAAALPALALEALLRPLPFGLLILGLVGSSLIAQRSLHWHVARVADALETGSLD
AAREAVGHIVGRDPQTLDASGVARAAIESLAENFSDGVVAPTLWLSVAGLAGGAAYKALN
TADSMIGHLTERHAAFGWAAARADDYVNLPASRLAGMLIIAGAALTPGAHPHHSHRAMLR
DAPRHRSPNAGWPEAAMAGALGLRLNGPKVYAGVLTQDAYMGDGRREATAQDVRMALKVY
RRADALMILLVLAGAALSLLL