Protein Info for GFF3729 in Sphingobium sp. HT1-2

Annotation: Flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00207: flagellar motor switch protein FliG" amino acids 11 to 336 (326 residues), 250.1 bits, see alignment E=1.9e-78 PF14842: FliG_N" amino acids 12 to 112 (101 residues), 90.9 bits, see alignment E=1.5e-29 amino acids 131 to 228 (98 residues), 27.1 bits, see alignment E=1e-09 PF14841: FliG_M" amino acids 123 to 187 (65 residues), 74.7 bits, see alignment E=1.1e-24 PF01706: FliG_C" amino acids 225 to 330 (106 residues), 117.7 bits, see alignment E=5.9e-38

Best Hits

Swiss-Prot: 38% identical to FLIG_VIBCH: Flagellar motor switch protein FliG (fliG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 92% identity to sch:Sphch_2646)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF3729 Flagellar motor switch protein FliG (Sphingobium sp. HT1-2)
MPEIVPGRPEALKGSAAAAVLLMLFDEDEAAQILSRLEPEEVRQLGYAMYDVQDVDPEEV
NEALDHFVTKAKKRTTIGYGATRHIRGAMTKALGEERAETILARITPPTRSTQLEMLKWM
DAKEIAILIEMEHPQIMAIVLAHLEAPVAADVLQLLPTEYQEEIVYRIATLGPVSNEALD
DLEQLLLRGPVNKQGAASQRGGTVEAAAIMNNVRKDNEQRIMKAVAKRDKMIAQTIEEEM
FVFDNLIDMDDKNLGTLMRTVDSQVLVVALKGANDMLKAKIFSCMSARAAQAIADEIEER
GPIRLAEVIDAQKLIIATARRMADAGTIMLGGKGNDFV