Protein Info for GFF3727 in Sphingobium sp. HT1-2

Annotation: Flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02049: FliE
  • amino acids 38 to 119 (82 residues), 97.8 bits, E=1.6e-32
• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 46 to 118 (73 residues), 60 bits, E=1.4e-20

Best Hits

Swiss-Prot: 39% identical to FLIE_SACD2: Flagellar hook-basal body complex protein FliE (fliE) from Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 84% identity to sjp:SJA_C1-30840)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Protein Sequence (119 amino acids)

>GFF3727 Flagellar hook-basal body complex protein FliE (Sphingobium sp. HT1-2)
MTGISPTDSVMAMRNAILQKNAALRDVASTGNVGSTGGAGATQGTAPGGFTDALNNALQQ
VNGLQTQAGDAASAFERGETTDIAAVMLAKQQASVSFEATLQVRNKLLSAYKDIMSMPV