Protein Info for GFF3726 in Sphingobium sp. HT1-2

Annotation: Flagellar two-component response regulator FleR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF00158: Sigma54_activat" amino acids 109 to 270 (162 residues), 216.4 bits, see alignment E=5.2e-68 PF14532: Sigma54_activ_2" amino acids 118 to 275 (158 residues), 55.6 bits, see alignment E=1.8e-18 PF07728: AAA_5" amino acids 128 to 247 (120 residues), 23.7 bits, see alignment E=1e-08 PF25601: AAA_lid_14" amino acids 277 to 346 (70 residues), 46.9 bits, see alignment E=5e-16 PF02954: HTH_8" amino acids 386 to 418 (33 residues), 39.1 bits, see alignment (E = 1.3e-13)

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 88% identity to sjp:SJA_C1-30850)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>GFF3726 Flagellar two-component response regulator FleR (Sphingobium sp. HT1-2)
MSSLDVSRGVCALVPGLQHWLENALYTVRIVDAQSPRERDSRRVLLATEIGHATHRDILI
NLVDGKPSLVPAANGLPVRVAFGLEDMGFAFALIAELARPASVPAVGDAASARLMTLAGR
VARSDATVLIQGDTGTGKEGMARFLHTQSGRVTHDFIAVNCAALPETMMEAMLFGHKKGS
FTGASNASDGLFLAADGGTLFLDEIAELPLALQAKLLRALQEGEVLPVGATHPVPVNVRI
VAACNRNLADEVAAGRFREDLYWRLNVMALELRPLAERPGDIAAIAAAMLLRHQDAGKDG
FVWPTAAALDKLAAHRWQGNARELGNVLQRALVLRDGERIEADDLHVAGAPQPLRIVPAA
PVAAVAAAPAEPIRLRDVAHHSKLQAIRTALRETDGHRAAAARKLGISERTLRYRLAEMR
ELAAA