Protein Info for GFF3723 in Xanthobacter sp. DMC5
Annotation: Apolipoprotein N-acyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to LNT_BRADU: Apolipoprotein N-acyltransferase (lnt) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 76% identity to xau:Xaut_1814)Predicted SEED Role
"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-
Use Curated BLAST to search for 2.3.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (549 amino acids)
>GFF3723 Apolipoprotein N-acyltransferase (Xanthobacter sp. DMC5) VAFPSKVAPRRGAPVSGLSWRGRILMLRFLTGWRRRFVAWTAGAVGALAMPPFDLWPVLA LSFPVLLLLLDGCRGDLKTRLLAAAGVGWWFGFGYFLASLWWIGAAFLVEADVFGWLLPF AVVAMPAGLALFTAFGTVVARLLWSKGGLRLFALTFGLTLAEWLRGHVLTGFPWNTYGYA VSDDLLLMQAASVIGVWGLTFFCVLLLSTPVLLLNPNRRSFAAVGAAALVIAGTALWGGY RLSVTPLETVPGVALRVMQPNLSQDKKFAYDRREQILKDYLALSAKKSETYPGGLADVTV LIWPESSFPFIYEREPWAAEAIAAVLPPNVTLVTGAVRYDFPPPGQRSPFFNSIRVMDHR GRVLENTDKVHLVPFGEYLPFQAELEALGIEQLTRVRGGFSSGAAFRALQIPGLPLASPL VCYEIIFPGKVVPQGPHPAWLLNLTNDAWFGLTPGPYQHFAQARMRAVEEGLPLVRAANT GISAIVDPLGRIVASHGLGLEGLVDGPLPKPLQTVSLAAKLGRTVIFALLAMALALASVP LCGCITRKG