Protein Info for GFF3723 in Sphingobium sp. HT1-2

Annotation: Glucans biosynthesis glucosyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 transmembrane" amino acids 47 to 65 (19 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 280 to 294 (15 residues), see Phobius details amino acids 401 to 428 (28 residues), see Phobius details amino acids 438 to 459 (22 residues), see Phobius details amino acids 478 to 502 (25 residues), see Phobius details amino acids 521 to 544 (24 residues), see Phobius details amino acids 550 to 571 (22 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 136 to 312 (177 residues), 27.2 bits, see alignment E=5.3e-10 PF13506: Glyco_transf_21" amino acids 223 to 374 (152 residues), 26 bits, see alignment E=8.6e-10 PF13632: Glyco_trans_2_3" amino acids 228 to 438 (211 residues), 65.8 bits, see alignment E=7.1e-22

Best Hits

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 80% identity to sjp:SJA_C1-30880)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (620 amino acids)

>GFF3723 Glucans biosynthesis glucosyltransferase H (Sphingobium sp. HT1-2)
VADGATGSQALVRAFESVPAEAPLAMPVQDFATAPGRIHRPLNIDLWARRLLVVLLALLP
AALAAHEMRRSIGLDGISFWEGVYLALFIPLFAWIAFGFATAAIGFLLLTVGKGKGVRPY
IPRDRTPLKARTAILLPVCNEDFLGVLGRLSIMERSLSQVMGGERFEFFILSDSNPENGE
TERKAYLEMRKAFSRPVHYRRRARNIGRKPGNIEEWVTRFGGAYDHMIVLDADSVMSGQT
MARLSVDMERHPHLGLIQTVPTVMGAATLFARWQQFASRLFGPISAAGMIWWAGSEGMFW
GHNAIVRVRAFAESCGLPELPGRAPFGGHILSHDMLEAALLRRRGWDVHMVTADDSFEEF
PPAMPDLFTRDRRWCQGNIQHVPLLAKIKGLHPVSRFQLFVGASAYCTSPLWLAMMLVVL
GGVATGVWPPAAVLPSSTLLTVTAVLLFGPKILAIGWAMADPSRRIGFGGAVRMTRGVIA
DIILSILMAPVAMLTQTINLFSILMGRKASWNGQTRDRDGMAILGAIWLFKWHILLGVGL
AVLAVRANAIGWMSPVLAGLFAAPILAALTARKDLGQRAENSGLFQVPEPWWRTQNYRPL
RFRWPVPGRKASVSRPANDG